PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen10g036050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TALE
Protein Properties Length: 402aa    MW: 45436 Da    PI: 8.4106
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen10g036050.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.5e-092993312254
                       SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       ++yp+ +++  LAk++gL+ +qV++WF N R +
  Sopen10g036050.1 299 HPYPTDSDKIMLAKQTGLSRNQVSNWFINARVR 331
                       89*****************************87 PP

2BELL71.81.1e-23187253272
              BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       ++e+ +  +k +s+l+eV++rYk y+eqlq v+ssFe vag+g+    ++l lka+ +hFrcL   i++q+
  Sopen10g036050.1 187 NHEHMRNNSKFISMLDEVYRRYKEYYEQLQGVVSSFESVAGVGN----ANLSLKALCKHFRCLIKSICDQM 253
                       57888999************************************....689*****************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.9E-20141251IPR006563POX domain
PfamPF075261.0E-21146249IPR006563POX domain
PROSITE profilePS5007111.791272335IPR001356Homeobox domain
SMARTSM003891.3E-9275339IPR001356Homeobox domain
CDDcd000861.54E-11275336No hitNo description
SuperFamilySSF466894.19E-17277343IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-27278339IPR009057Homeodomain-like
PfamPF059204.9E-19292331IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MCCVSLYPAT KEGFEAYHVP QQSRRDKLRG DPNYFYNNNN PSFLLNPCDN KTMDPQIISS  60
SFQQINNNPF LYNTNQNHDM NVNSNNITPG QGLSLSLSSN NHHHTTVPLE LRSLFTTTTT  120
VDCCSNNEFL SSKSGGSTIV GPFTSILKGS RFLKPAQQLM QDISGIYAHK LLQDHHHSLG  180
TMDDVSNHEH MRNNSKFISM LDEVYRRYKE YYEQLQGVVS SFESVAGVGN ANLSLKALCK  240
HFRCLIKSIC DQMKSSEINC DGNVCNNLER GGYVWRPQRG LPERAVTLLR AWLFDHFLHP  300
YPTDSDKIML AKQTGLSRNQ VSNWFINARV RVWKPMVEEI HMLENNKSSS QAQNNNNPEM  360
NLSSSGGVSL TLGLNHQNKN NALSFPRNAA RRFGIDPNNI IA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5bng_A8e-16281339159Homeobox protein Meis2
5bng_B8e-16281339159Homeobox protein Meis2
4xrs_B9e-16281338158Homeobox protein Meis1
4xrs_A9e-16281338158Homeobox protein Meis1
3k2a_B1e-15281339563Homeobox protein Meis2
3k2a_A1e-15281339563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754490.0HG975449.1 Solanum pennellii chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015089273.10.0PREDICTED: BEL1-like homeodomain protein 9 isoform X1
SwissprotQ9LZM87e-78BLH9_ARATH; BEL1-like homeodomain protein 9
TrEMBLM1BNG61e-173M1BNG6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000492351e-173(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35202237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.12e-77TALE family protein